PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g11940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WRKY
Protein Properties Length: 193aa    MW: 21793.8 Da    PI: 6.9337
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g11940genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.51.4e-3360117260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+  d++v+ei+Y+g+Hnh+k
  CA09g11940  60 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERNL-DGHVTEIVYKGSHNHPK 117
                 8****************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.4154118IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.0E-2854119IPR003657WRKY domain
SuperFamilySSF1182902.48E-2555118IPR003657WRKY domain
SMARTSM007744.0E-3559117IPR003657WRKY domain
PfamPF031061.9E-2560116IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MKQDDLITRQ QQTTEFSTAK IGVKSEVAPI QSFSQENMQN NPAPMHYCQP SQYVREQKAE  60
DGYNWRKYGQ KQVKGSENPR SYYKCTFPNC PTKKKVERNL DGHVTEIVYK GSHNHPKPQS  120
TRRSSAQSIQ NLAYSNLDIT NQPNAFLENA QRDSLAVTDN SSASFGDEDV DQGSPISKSG  180
ENDENEPEAK RW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-16591181474WRKY transcription factor 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3917470.0AY391747.1 Capsicum annuum WRKY transcription factor-a (WRKY-a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016542030.11e-137PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P55e-45WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA8KRX21e-136A8KRX2_CAPCH; WRKY transcription factor (Fragment)
STRINGSolyc09g014990.2.11e-123(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-46WRKY DNA-binding protein 33